PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12834A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 431aa    MW: 46936.2 Da    PI: 6.1498
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12834AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85e-18118164148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                + +WT+eEd +l++ v q+G + W+ Ia++++ gR +kqc++rw ++l
  Oropetium_20150105_12834A 118 KSSWTEEEDSILKHMVVQHGERKWSVIAQCLP-GRIGKQCRERWINHL 164
                                578*****************************.************996 PP

2Myb_DNA-binding50.35.6e-16174213445
                                S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                W++e+d ll++a++ +G++ W++Ia+++  gR+++ +k++w+
  Oropetium_20150105_12834A 174 WSEEDDRLLINAHRHFGNR-WSSIAKHIS-GRSENAVKNHWN 213
                                *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.445113168IPR017930Myb domain
SMARTSM007171.0E-16117166IPR001005SANT/Myb domain
SuperFamilySSF466891.4E-28117212IPR009057Homeodomain-like
PfamPF002499.5E-16118164IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-22118166IPR009057Homeodomain-like
CDDcd001675.34E-16120164No hitNo description
Gene3DG3DSA:1.10.10.604.6E-18167217IPR009057Homeodomain-like
SMARTSM007175.4E-14170218IPR001005SANT/Myb domain
PROSITE profilePS5129417.813170220IPR017930Myb domain
PfamPF002492.1E-14174213IPR001005SANT/Myb domain
CDDcd001673.80E-13174216No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MADGSSSVPM EERQAPPLTA DWTPVRYFVS SGAHFQNGVA PASFVHAVGG DQFTVGAPFD  60
VSSVMTRIGM IPAAFEMPEG AYAATGFDAI RGVPAELAMA QQQLTGSNGS GRLPAPPKSS  120
WTEEEDSILK HMVVQHGERK WSVIAQCLPG RIGKQCRERW INHLRPDIKQ NDIWSEEDDR  180
LLINAHRHFG NRWSSIAKHI SGRSENAVKN HWNATLRSLK AKRRLKKKKS EQAPPGQYSA  240
LEEYIRSLYL LEDGVPPEAP PPSSTPPHFL AYDGSDHPAV VAPAPEVSSI PATNTEMMSF  300
HGDNSAVGSS NLGMINLNVP PQLPDLNTTT SDPQQEYYYM NYPVYVPAPP EPLLQLATHQ  360
EDTPQSCSSL DLFPYADYFA LLRTDYGNYH EGASSSNPSG ANGYYYSEAR RSRAAGGSGG  420
RPAGNTDNVV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-371182174102C-Myb DNA-Binding Domain
1msf_C3e-371182174102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.11e-114PREDICTED: uncharacterized protein LOC101784221
TrEMBLK3XS581e-114K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m1e-114(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.15e-40myb domain protein 64